PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G03385.1.p
Common NameEUGRSUZ_G03385, LOC104454661
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 329aa    MW: 36390.7 Da    PI: 5.0677
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G03385.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-152976148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
  Eucgr.G03385.1.p 29 KGLWSPEEDEKLMRYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 76
                      678*******************************************97 PP

2Myb_DNA-binding53.94e-1782126147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+++++E+el+v++++ lG++ W+ Ia++++ gRt++++k++w++ 
  Eucgr.G03385.1.p  82 RGAFSPQEEELIVHLHNILGNR-WSQIAARLP-GRTDNEIKNFWNST 126
                       89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3692476IPR017930Myb domain
SuperFamilySSF466891.14E-2827123IPR009057Homeodomain-like
SMARTSM007172.1E-112878IPR001005SANT/Myb domain
PfamPF002496.0E-142976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-233083IPR009057Homeodomain-like
CDDcd001673.76E-103276No hitNo description
PROSITE profilePS5129425.54577131IPR017930Myb domain
SMARTSM007171.6E-1681129IPR001005SANT/Myb domain
PfamPF002491.9E-1582126IPR001005SANT/Myb domain
CDDcd001673.16E-1284127No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2684131IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MRKPSETMGM AMGIKEKASS NPHNHKLRKG LWSPEEDEKL MRYMLTNGQG CWSDIARNAG  60
LQRCGKSCRL RWINYLRPDL KRGAFSPQEE ELIVHLHNIL GNRWSQIAAR LPGRTDNEIK  120
NFWNSTLKKR LKMNSATSSS NESDLSNPQD IAAGIMPSFH AQYDVLATCM DSSPAPFPPM  180
DNISAPNQFD PFPTLNNRCD TWEGVGFFTF PSGIAPVSMG DDSSYLNLEH AKVGLLGSEF  240
SVPPLASSTT TTEENNYRSI GCGMDGKGEN SFSNNNDSCF SNTTTASFKA EDDMSGFGNN  300
LQAANLRIGE WDLEGLMDDL PSFPFLDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-27261311105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126132LKKRLKM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G03385.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5760230.0AJ576023.1 Eucalyptus gunnii mRNA for MYB transcription factor (myb2 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067873.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A059BJ330.0A0A059BJ33_EUCGR; Uncharacterized protein
STRINGPOPTR_0009s06630.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70772642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.13e-80myb domain protein 83